PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn385891
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Nin-like
Protein Properties Length: 471aa    MW: 53201.1 Da    PI: 4.974
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn385891genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK82.83.4e-26295344352
      RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 k +s e +s+yF++pi++AAkeL+v+lT+LK++CR++GI+RWPhRk+ sl
  Achn385891 295 KALSREIISQYFYMPITQAAKELNVGLTLLKKRCRELGIRRWPHRKLMSL 344
                 78999******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.10.450.403.4E-3284180No hitNo description
PfamPF115237.1E-24103175IPR021602Protein of unknown function DUF3223
PROSITE profilePS5151918.349275365IPR003035RWP-RK domain
PfamPF020421.7E-21297344IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MAEAAATEAP ETAQDMELEN QNTAAEESTG DAAVNGGEGE ENSKRAREEE AEEESGGEKK  60
QKIEKSAEEE RFEKLDGGEE SDRVGLGPKS FGSSVEMFDY FYKLLHYWPP NLNVNKYEHM  120
MLLDLLKKGH LEPEKKIGEG AAAFQVRYHP QWKSRCFFII RTDESVDDFS FRKCVDHILP  180
LPENMQIKSD VNKALGGGGR GHGGRGGGGG RGGGHGRGRG GRGRREDFLF GNGNDYGVWN  240
HEMGSHATGF EPQNQPFLLC GNEEEVTEEY VGERKAQRKA QRNREEKISN NSCSKALSRE  300
IISQYFYMPI TQAAKELNVG LTLLKKRCRE LGIRRWPHRK LMSLQTLIKN VQEMDNEEGD  360
GAEGKLKEAL EILEQERKLM EEVPDLELED KTKRLRQACF KANYKKRKLM GTTKTIIGQA  420
DSYPYSSTTN RDFYKDDTAN YGIWDDDEDE EQVMKSLLSD DGFSSPDVWF *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1202209GGRGGGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.17e-57RWP-RK domain-containing protein